General Information

  • ID:  hor007103
  • Uniprot ID:  P80703??25-186)
  • Protein name:  Apolipophorin-3
  • Gene name:  burs124
  • Organism:  Galleria mellonella
  • Family:  Insect apolipophorin-3 family
  • Source:  Animal
  • Expression:  Expressed in hemolymph (PubMed-17194500; PubMed-29289504). Also found in hemocytes and fat body (PubMed-29289504).
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Ecdysozoa; Panarthropoda; Arthropoda; Mandibulata; Pancrustacea; Hexapoda; Insecta; Dicondylia; Pterygota (winged insects); Neoptera; Endopterygota; Amphiesmenoptera; Lepidoptera (butterflies and moths); Glossata; Neolepidoptera; Heteroneura; Ditrysia; Obtectomera; Pyraloidea; Pyralidae (snout moths); Galleriinae; Galleria; Galleria mellonella (Greater wax moth)
  • GO MF:  GO:0005615 extracellular space
  • GO BP:  GO:0008289 lipid binding
  • GO CC:  GO:0050830 defense response to Gram-positive bacterium; GO:0006869 lipid transport; GO:0045087 innate immune response

Sequence Information

  • Sequence:  ASTPLQDLEKHAAEFQKTFSEQLNAFTNSKDTKEFNTALKEGSDSVLQQLNALASSLQKALNDANGKAKEALEQTRTNLERTAEELRRAHPDVERQAGALRDRLQTAVQATVQETQKLAKTVGANLEETNKKLAPQIKSAYDDFVKQAQEVQKKLHEAASKQ
  • Length:  162
  • Propeptide:  MAAKYVFVVAACSALAQAGIVRRDASTPLQDLEKHAAEFQKTFSEQLNAFTNSKDTKEFNTALKEGSDSVLQQLNALASSLQKALNDANGKAKEALEQTRTNLERTAEELRRAHPDVERQAGALRDRLQTAVQATVQETQKLAKTVGANLEETNKKLAPQIKSAYDDFVKQAQEVQKKLHEAASKQ
  • Signal peptide:  MAAKYVFVVAACSALAQA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA